ADAL purified MaxPab mouse polyclonal antibody (B01P) View larger

ADAL purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAL purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ADAL purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00161823-B01P
Product name: ADAL purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ADAL protein.
Gene id: 161823
Gene name: ADAL
Gene alias: DKFZp313B2137|FLJ44620
Gene description: adenosine deaminase-like
Genbank accession: NM_001012969
Immunogen: ADAL (NP_001012987, 1 a.a. ~ 267 a.a) full-length human protein.
Immunogen sequence/protein sequence: MIEAEEQQPCKTDFYSELPKVELHAHLNGSISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMFQTIHQLTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLSGDPTVGQAKDFLEPLLEAKKAGLKLALHLSEIPNQKKETQILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLGKAWSFRSSR
Protein accession: NP_001012987
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00161823-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ADAL expression in transfected 293T cell line (H00161823-T01) by ADAL MaxPab polyclonal antibody.

Lane 1: ADAL transfected lysate(29.37 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ADAL purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart