Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DYX1C1 monoclonal antibody (M09), clone 6G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,IP |
More info about DYX1C1 monoclonal antibody (M09), clone 6G1
| Brand: | Abnova |
| Reference: | H00161582-M09 |
| Product name: | DYX1C1 monoclonal antibody (M09), clone 6G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DYX1C1. |
| Clone: | 6G1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 161582 |
| Gene name: | DYX1C1 |
| Gene alias: | DYX1|DYXC1|EKN1|FLJ37882|MGC70618|RD |
| Gene description: | dyslexia susceptibility 1 candidate 1 |
| Genbank accession: | NM_130810 |
| Immunogen: | DYX1C1 (NP_570722, 336 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KLKNLHKAIEDSSKALELLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEKIRNVIQGTELKS |
| Protein accession: | NP_570722 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of DYX1C1 transfected lysate using anti-DYX1C1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DYX1C1 MaxPab rabbit polyclonal antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |