No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,IP |
Brand: | Abnova |
Reference: | H00161582-M09 |
Product name: | DYX1C1 monoclonal antibody (M09), clone 6G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DYX1C1. |
Clone: | 6G1 |
Isotype: | IgG2a Kappa |
Gene id: | 161582 |
Gene name: | DYX1C1 |
Gene alias: | DYX1|DYXC1|EKN1|FLJ37882|MGC70618|RD |
Gene description: | dyslexia susceptibility 1 candidate 1 |
Genbank accession: | NM_130810 |
Immunogen: | DYX1C1 (NP_570722, 336 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KLKNLHKAIEDSSKALELLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEKIRNVIQGTELKS |
Protein accession: | NP_570722 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoprecipitation of DYX1C1 transfected lysate using anti-DYX1C1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DYX1C1 MaxPab rabbit polyclonal antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |