View larger

RHOXF1 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of RHOXF1 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00158800-B01P
Product name:	RHOXF1 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human RHOXF1 protein.
Gene id:	158800
Gene name:	RHOXF1
Gene alias:	MGC119030\|MGC119033\|OTEX\|PEPP1
Gene description:	Rhox homeobox family, member 1
Genbank accession:	NM_139282.1
Immunogen:	RHOXF1 (NP_644811.1, 1 a.a. ~ 184 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVYIVVD
Protein accession:	NP_644811.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of RHOXF1 expression in transfected 293T cell line (H00158800-T01) by RHOXF1 MaxPab polyclonal antibody. Lane 1: RHOXF1 transfected lysate(20.24 KDa). Lane 2: Non-transfected lysate.
Applications:	IF,WB-Tr
Shipping condition:	Dry Ice