No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00157285-M01 |
Product name: | DKFZp761P0423 monoclonal antibody (M01), clone 5C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DKFZp761P0423. |
Clone: | 5C6 |
Isotype: | IgG2a Kappa |
Gene id: | 157285 |
Gene name: | PRAGMIN |
Gene alias: | DKFZp761P0423 |
Gene description: | homolog of rat pragma of Rnd2 |
Genbank accession: | XM_291277 |
Immunogen: | DKFZp761P0423 (XP_291277, 2 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRLPPRPENCRLEDEGVNSSPYSKPTIAVKPTMMSSEASDVWTE |
Protein accession: | XP_291277 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to DKFZp761P0423 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.2 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |