CNKSR3 monoclonal antibody (M01), clone 4A11 View larger

CNKSR3 monoclonal antibody (M01), clone 4A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNKSR3 monoclonal antibody (M01), clone 4A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about CNKSR3 monoclonal antibody (M01), clone 4A11

Brand: Abnova
Reference: H00154043-M01
Product name: CNKSR3 monoclonal antibody (M01), clone 4A11
Product description: Mouse monoclonal antibody raised against a partial recombinant CNKSR3.
Clone: 4A11
Isotype: IgG2b Kappa
Gene id: 154043
Gene name: CNKSR3
Gene alias: FLJ31349|MAGI1
Gene description: CNKSR family member 3
Genbank accession: NM_173515
Immunogen: CNKSR3 (NP_775786, 366 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRY
Protein accession: NP_775786
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00154043-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00154043-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CNKSR3 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CNKSR3 monoclonal antibody (M01), clone 4A11 now

Add to cart