Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SH3D19 monoclonal antibody (M01), clone 5C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,ELISA,WB-Re |
More info about SH3D19 monoclonal antibody (M01), clone 5C7
| Brand: | Abnova |
| Reference: | H00152503-M01 |
| Product name: | SH3D19 monoclonal antibody (M01), clone 5C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SH3D19. |
| Clone: | 5C7 |
| Isotype: | IgG3 Kappa |
| Gene id: | 152503 |
| Gene name: | SH3D19 |
| Gene alias: | EBP|EVE1|Kryn|MGC105136|MGC118910|MGC118911|MGC118912|MGC118913|SH3P19 |
| Gene description: | SH3 domain containing 19 |
| Genbank accession: | NM_001009555 |
| Immunogen: | SH3D19 (NP_001009555, 94 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDSGKKVPTPAPRPLLLKKSVSSENPTYPSAPLKPVTVPPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLVDIDLI |
| Protein accession: | NP_001009555 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | SH3D19 monoclonal antibody (M01), clone 5C7 Western Blot analysis of SH3D19 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |