CCDC12 monoclonal antibody (M05), clone 7B1 View larger

CCDC12 monoclonal antibody (M05), clone 7B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCDC12 monoclonal antibody (M05), clone 7B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about CCDC12 monoclonal antibody (M05), clone 7B1

Brand: Abnova
Reference: H00151903-M05
Product name: CCDC12 monoclonal antibody (M05), clone 7B1
Product description: Mouse monoclonal antibody raised against a full-length recombinant CCDC12.
Clone: 7B1
Isotype: IgG2a Kappa
Gene id: 151903
Gene name: CCDC12
Gene alias: FLJ39430|MGC23918
Gene description: coiled-coil domain containing 12
Genbank accession: NM_144716.1
Immunogen: CCDC12 (NP_653317.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD
Protein accession: NP_653317.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00151903-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.6 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00151903-M05-1-19-1.jpg
Application image note: CCDC12 monoclonal antibody (M05), clone 7B1. Western Blot analysis of CCDC12 expression in IMR-32.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CCDC12 monoclonal antibody (M05), clone 7B1 now

Add to cart