| Brand: | Abnova |
| Reference: | H00151903-M05 |
| Product name: | CCDC12 monoclonal antibody (M05), clone 7B1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CCDC12. |
| Clone: | 7B1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 151903 |
| Gene name: | CCDC12 |
| Gene alias: | FLJ39430|MGC23918 |
| Gene description: | coiled-coil domain containing 12 |
| Genbank accession: | NM_144716.1 |
| Immunogen: | CCDC12 (NP_653317.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD |
| Protein accession: | NP_653317.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.6 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CCDC12 monoclonal antibody (M05), clone 7B1. Western Blot analysis of CCDC12 expression in IMR-32. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |