No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00151636-M01 |
Product name: | DTX3L monoclonal antibody (M01), clone 1D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DTX3L. |
Clone: | 1D10 |
Isotype: | IgG2a Kappa |
Gene id: | 151636 |
Gene name: | DTX3L |
Gene alias: | BBAP |
Gene description: | deltex 3-like (Drosophila) |
Genbank accession: | NM_138287 |
Immunogen: | DTX3L (NP_612144, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAE |
Protein accession: | NP_612144 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | DTX3L monoclonal antibody (M01), clone 1D10 Western Blot analysis of DTX3L expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |