GDF7 monoclonal antibody (M04), clone 3C2 View larger

GDF7 monoclonal antibody (M04), clone 3C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GDF7 monoclonal antibody (M04), clone 3C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about GDF7 monoclonal antibody (M04), clone 3C2

Brand: Abnova
Reference: H00151449-M04
Product name: GDF7 monoclonal antibody (M04), clone 3C2
Product description: Mouse monoclonal antibody raised against a partial recombinant GDF7.
Clone: 3C2
Isotype: IgG2a Kappa
Gene id: 151449
Gene name: GDF7
Gene alias: BMP12
Gene description: growth differentiation factor 7
Genbank accession: NM_182828
Immunogen: GDF7 (NP_878248, 361 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Protein accession: NP_878248
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00151449-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00151449-M04-1-33-1.jpg
Application image note: GDF7 monoclonal antibody (M04), clone 3C2. Western Blot analysis of GDF7 expression in FHs 173 WE.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GDF7 monoclonal antibody (M04), clone 3C2 now

Add to cart