Cart 7 Product Products 3 087,92 € (empty)
-
-
-
1 x Chicken...275,00 € -
-
1 x MAD MOUSE532,92 € -
-
No products
247,00 € DAP Shipping
3 334,92 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 087,92 €
Total shipping (tax excl.) 247,00 €
Total (tax excl.) 3 334,92 €
Data sheet of GDF7 monoclonal antibody (M02), clone 4F10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about GDF7 monoclonal antibody (M02), clone 4F10
| Brand: | Abnova |
| Reference: | H00151449-M02 |
| Product name: | GDF7 monoclonal antibody (M02), clone 4F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GDF7. |
| Clone: | 4F10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 151449 |
| Gene name: | GDF7 |
| Gene alias: | BMP12 |
| Gene description: | growth differentiation factor 7 |
| Genbank accession: | NM_182828 |
| Immunogen: | GDF7 (NP_878248, 361 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
| Protein accession: | NP_878248 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GDF7 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |