Cart 22 Product Products 7 038,00 € (empty)
-
-
-
-
-
-
-
1 x Phospho-Ak...259,07 € -
-
-
-
-
-
-
-
-
-
1 x Phospho-NF...259,07 € -
-
-
-
1 x Goat...225,00 € -
No products
To be determined Shipping
7 038,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 22 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 7 038,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 7 038,00 €
Data sheet of OTOS monoclonal antibody (M02), clone 6C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about OTOS monoclonal antibody (M02), clone 6C6
| Brand: | Abnova |
| Reference: | H00150677-M02 |
| Product name: | OTOS monoclonal antibody (M02), clone 6C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant OTOS. |
| Clone: | 6C6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 150677 |
| Gene name: | OTOS |
| Gene alias: | OTOSP |
| Gene description: | otospiralin |
| Genbank accession: | NM_148961 |
| Immunogen: | OTOS (NP_683764.1, 26 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTFFAHFPLGSTLGFHVPYQED |
| Protein accession: | NP_683764.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged OTOS is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |