Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of WFDC5 monoclonal antibody (M08), clone 3E5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about WFDC5 monoclonal antibody (M08), clone 3E5
| Brand: | Abnova |
| Reference: | H00149708-M08 |
| Product name: | WFDC5 monoclonal antibody (M08), clone 3E5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant WFDC5. |
| Clone: | 3E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 149708 |
| Gene name: | WFDC5 |
| Gene alias: | PRG5|WAP1|dJ211D12.5 |
| Gene description: | WAP four-disulfide core domain 5 |
| Genbank accession: | BC039173 |
| Immunogen: | WFDC5 (AAH39173, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG |
| Protein accession: | AAH39173 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |