Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of WFDC5 monoclonal antibody (M03), clone 5G5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
More info about WFDC5 monoclonal antibody (M03), clone 5G5
| Brand: | Abnova |
| Reference: | H00149708-M03 |
| Product name: | WFDC5 monoclonal antibody (M03), clone 5G5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant WFDC5. |
| Clone: | 5G5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 149708 |
| Gene name: | WFDC5 |
| Gene alias: | PRG5|WAP1|dJ211D12.5 |
| Gene description: | WAP four-disulfide core domain 5 |
| Genbank accession: | NM_145652 |
| Immunogen: | WFDC5 (NP_663627, 25 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG |
| Protein accession: | NP_663627 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of WFDC5 expression in transfected 293T cell line by WFDC5 monoclonal antibody (M03), clone 5G5. Lane 1: WFDC5 transfected lysate (Predicted MW: 13.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |