| Brand: | Abnova |
| Reference: | H00149095-M04 |
| Product name: | DCST1 monoclonal antibody (M04), clone 2C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DCST1. |
| Clone: | 2C12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 149095 |
| Gene name: | DCST1 |
| Gene alias: | FLJ32785|RP11-307C12.10 |
| Gene description: | DC-STAMP domain containing 1 |
| Genbank accession: | NM_152494 |
| Immunogen: | DCST1 (NP_689707, 532 a.a. ~ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MESNNMPCLPQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLKKRAAFTKLRRAAILRRERQQKAPRHPLADI |
| Protein accession: | NP_689707 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DCST1 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |