MOBKL2C polyclonal antibody (A01) View larger

MOBKL2C polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MOBKL2C polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MOBKL2C polyclonal antibody (A01)

Brand: Abnova
Reference: H00148932-A01
Product name: MOBKL2C polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MOBKL2C.
Gene id: 148932
Gene name: MOBKL2C
Gene alias: MGC26743|MOB3C
Gene description: MOB1, Mps One Binder kinase activator-like 2C (yeast)
Genbank accession: NM_201403
Immunogen: MOBKL2C (NP_958805, 121 a.a. ~ 216 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH
Protein accession: NP_958805
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00148932-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.67 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MOBKL2C polyclonal antibody (A01) now

Add to cart