| Brand: | Abnova |
| Reference: | H00148327-M01 |
| Product name: | CREB3L4 monoclonal antibody (M01), clone 3E3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CREB3L4. |
| Clone: | 3E3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 148327 |
| Gene name: | CREB3L4 |
| Gene alias: | AIBZIP|ATCE1|CREB3|CREB4|JAL|hJAL |
| Gene description: | cAMP responsive element binding protein 3-like 4 |
| Genbank accession: | NM_130898 |
| Immunogen: | CREB3L4 (NP_570968, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP |
| Protein accession: | NP_570968 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of CREB3L4 over-expressed 293 cell line, cotransfected with CREB3L4 Validated Chimera RNAi ( Cat # H00148327-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CREB3L4 monoclonal antibody (M01), clone 3E3 (Cat # H00148327-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce |
| Shipping condition: | Dry Ice |