Brand: | Abnova |
Reference: | H00146310-M02 |
Product name: | RNF151 monoclonal antibody (M02), clone 4G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF151. |
Clone: | 4G8 |
Isotype: | IgG1 Kappa |
Gene id: | 146310 |
Gene name: | RNF151 |
Gene alias: | MGC129921 |
Gene description: | ring finger protein 151 |
Genbank accession: | XM_370927 |
Immunogen: | RNF151 (NP_056484, 68 a.a. ~ 173 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HMNKLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGCGATLDPAERARHNCYRELHNAWSVRQE |
Protein accession: | NP_056484 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RNF151 is approximately 0.03ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |