View larger

RNF151 monoclonal antibody (M02), clone 4G8

Reference:

Condition: New product

Data sheet of RNF151 monoclonal antibody (M02), clone 4G8

Brand:	Abnova
Reference:	H00146310-M02
Product name:	RNF151 monoclonal antibody (M02), clone 4G8
Product description:	Mouse monoclonal antibody raised against a partial recombinant RNF151.
Clone:	4G8
Isotype:	IgG1 Kappa
Gene id:	146310
Gene name:	RNF151
Gene alias:	MGC129921
Gene description:	ring finger protein 151
Genbank accession:	XM_370927
Immunogen:	RNF151 (NP_056484, 68 a.a. ~ 173 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	HMNKLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGCGATLDPAERARHNCYRELHNAWSVRQE
Protein accession:	NP_056484
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.4 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged RNF151 is approximately 0.03ng/ml as a capture antibody.
Applications:	IF,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice