| Brand: | Abnova |
| Reference: | H00146059-M01 |
| Product name: | CDAN1 monoclonal antibody (M01), clone 7A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDAN1. |
| Clone: | 7A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 146059 |
| Gene name: | CDAN1 |
| Gene alias: | CDA-I|CDA1|CDAI|DLT|PRO1295|codanin |
| Gene description: | congenital dyserythropoietic anemia, type I |
| Genbank accession: | NM_138477 |
| Immunogen: | CDAN1 (NP_612486.2, 1130 a.a. ~ 1227 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS |
| Protein accession: | NP_612486.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDAN1 monoclonal antibody (M01), clone 7A10. Western Blot analysis of CDAN1 expression in K-562. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |