No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00146050-M03 |
Product name: | ZSCAN29 monoclonal antibody (M03), clone 2E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZSCAN29. |
Clone: | 2E8 |
Isotype: | IgG2a Kappa |
Gene id: | 146050 |
Gene name: | ZSCAN29 |
Gene alias: | FLJ35867|MGC129894|MGC129895|ZNF690|Zfp690 |
Gene description: | zinc finger and SCAN domain containing 29 |
Genbank accession: | NM_152455 |
Immunogen: | ZSCAN29 (NP_689668, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKERARSPDLGPQEQMNPKEKLKPFQRSGLPFPKSGVVSRLEQGEPWIPDLLGS |
Protein accession: | NP_689668 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to ZSCAN29 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |