| Brand: | Abnova |
| Reference: | H00145957-P01 |
| Product name: | NRG4 (Human) Recombinant Protein (P01) |
| Product description: | Human NRG4 full-length ORF ( AAH17568, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 145957 |
| Gene name: | NRG4 |
| Gene alias: | DKFZp779N0541|DKFZp779N1944|HRG4 |
| Gene description: | neuregulin 4 |
| Genbank accession: | BC017568 |
| Immunogen sequence/protein sequence: | MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH |
| Protein accession: | AAH17568 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Cardioprotective proteins upregulated in the liver in response to experimental myocardial ischemia.Liu SQ, Tefft BJ, Roberts DT, Zhang LQ, Ren Y, Li YC, Huang Y, Zhang D, Phillips HR, Wu YH. Am J Physiol Heart Circ Physiol. 2012 Dec;303(12):H1446-58. doi: 10.1152/ajpheart.00362.2012. Epub 2012 Oct 12. |