Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MESP2 monoclonal antibody (M03), clone 1E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about MESP2 monoclonal antibody (M03), clone 1E11
| Brand: | Abnova |
| Reference: | H00145873-M03 |
| Product name: | MESP2 monoclonal antibody (M03), clone 1E11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MESP2. |
| Clone: | 1E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 145873 |
| Gene name: | MESP2 |
| Gene alias: | SCDO2|bHLHc6 |
| Gene description: | mesoderm posterior 2 homolog (mouse) |
| Genbank accession: | XM_085261 |
| Immunogen: | MESP2 (XP_085261, 2 a.a. ~ 125 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETL* |
| Protein accession: | XP_085261 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |