GSC monoclonal antibody (M12), clone 3F10 View larger

GSC monoclonal antibody (M12), clone 3F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSC monoclonal antibody (M12), clone 3F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GSC monoclonal antibody (M12), clone 3F10

Brand: Abnova
Reference: H00145258-M12
Product name: GSC monoclonal antibody (M12), clone 3F10
Product description: Mouse monoclonal antibody raised against a partial recombinant GSC.
Clone: 3F10
Isotype: IgG2a Kappa
Gene id: 145258
Gene name: GSC
Gene alias: -
Gene description: goosecoid homeobox
Genbank accession: NM_173849
Immunogen: GSC (NP_776248, 151 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS
Protein accession: NP_776248
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00145258-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00145258-M12-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GSC is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GSC monoclonal antibody (M12), clone 3F10 now

Add to cart