No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00143384-A01 |
Product name: | C10orf46 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant C10orf46. |
Gene id: | 143384 |
Gene name: | C10orf46 |
Gene alias: | FLJ40409|MGC33215 |
Gene description: | chromosome 10 open reading frame 46 |
Genbank accession: | NM_153810 |
Immunogen: | C10orf46 (NP_722517, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | STININTSTSKFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMYSDLIKKITNHLERVSKELQASPPDLYIERF |
Protein accession: | NP_722517 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | C10orf46 polyclonal antibody (A01), Lot # ABNOVA060710QCS1 Western Blot analysis of C10orf46 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |