No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00143241-M02 |
| Product name: | DYDC1 monoclonal antibody (M02), clone 2B8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant DYDC1. |
| Clone: | 2B8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 143241 |
| Gene name: | DYDC1 |
| Gene alias: | DPY30D1|FLJ43920|bA36D19.5 |
| Gene description: | DPY30 domain containing 1 |
| Genbank accession: | BC019250 |
| Immunogen: | DYDC1 (AAH19250, 1 a.a. ~ 177 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL |
| Protein accession: | AAH19250 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged DYDC1 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |