RPL10L monoclonal antibody (M01), clone 1E9 View larger

RPL10L monoclonal antibody (M01), clone 1E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPL10L monoclonal antibody (M01), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about RPL10L monoclonal antibody (M01), clone 1E9

Brand: Abnova
Reference: H00140801-M01
Product name: RPL10L monoclonal antibody (M01), clone 1E9
Product description: Mouse monoclonal antibody raised against a partial recombinant RPL10L.
Clone: 1E9
Isotype: IgG1 Kappa
Gene id: 140801
Gene name: RPL10L
Gene alias: FLJ27353
Gene description: ribosomal protein L10-like
Genbank accession: NM_080746
Immunogen: RPL10L (NP_542784.1, 115 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRGAFGKPQGTVARVHIGQVIMSIRTKLQNEEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGCGVKYVPSHGPLDKWRVLHS
Protein accession: NP_542784.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00140801-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RPL10L is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy RPL10L monoclonal antibody (M01), clone 1E9 now

Add to cart