RNF32 purified MaxPab mouse polyclonal antibody (B02P) View larger

RNF32 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF32 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,WB-Tr

More info about RNF32 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00140545-B02P
Product name: RNF32 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human RNF32 protein.
Gene id: 140545
Gene name: RNF32
Gene alias: FKSG33|HSD15
Gene description: ring finger protein 32
Genbank accession: BC028120.1
Immunogen: RNF32 (AAH28120.1, 1 a.a. ~ 256 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLRKTVPPTDAKLRKNSLKKSSQKSATASCAHTTPTLKSSLQKSISAWP
Protein accession: AAH28120.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00140545-B02P-13-15-1.jpg
Application image note: Western Blot analysis of RNF32 expression in transfected 293T cell line (H00140545-T02) by RNF32 MaxPab polyclonal antibody.

Lane 1: RNF32 transfected lysate(28.16 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RNF32 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart