No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00140469-M01 |
Product name: | MYO3B monoclonal antibody (M01), clone 1D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MYO3B. |
Clone: | 1D1 |
Isotype: | IgG1 Kappa |
Gene id: | 140469 |
Gene name: | MYO3B |
Gene alias: | - |
Gene description: | myosin IIIB |
Genbank accession: | NM_138995 |
Immunogen: | MYO3B (NP_620482.1, 280 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVEDAEKYCLEDDLVNLEVLDEDTIIHQLQKRYAD |
Protein accession: | NP_620482.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged MYO3B is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |