MLC1SA MaxPab mouse polyclonal antibody (B01) View larger

MLC1SA MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MLC1SA MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MLC1SA MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00140465-B01
Product name: MLC1SA MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MLC1SA protein.
Gene id: 140465
Gene name: MYL6B
Gene alias: MLC1SA
Gene description: myosin, light chain 6B, alkali, smooth muscle and non-muscle
Genbank accession: NM_002475
Immunogen: MLC1SA (NP_002466, 1 a.a. ~ 208 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Protein accession: NP_002466
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00140465-B01-13-15-1.jpg
Application image note: Western Blot analysis of MYL6B expression in transfected 293T cell line (H00140465-T01) by MYL6B MaxPab polyclonal antibody.

Lane 1: MLC1SA transfected lysate(22.88 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MLC1SA MaxPab mouse polyclonal antibody (B01) now

Add to cart