Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RNF113B monoclonal antibody (M02), clone 2B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,IP |
More info about RNF113B monoclonal antibody (M02), clone 2B11
| Brand: | Abnova |
| Reference: | H00140432-M02 |
| Product name: | RNF113B monoclonal antibody (M02), clone 2B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF113B. |
| Clone: | 2B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 140432 |
| Gene name: | RNF113B |
| Gene alias: | MGC26599|RNF161|ZNF183L1|bA10G5.1 |
| Gene description: | ring finger protein 113B |
| Genbank accession: | NM_178861 |
| Immunogen: | RNF113B (NP_849192, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAPPSPGRTADQADQVCTFLFKKPGRKGAAGLRKRPACDPEHGESSSSGDEGDTVAQPPRVAPRPRGLHSWQKAAHGDRRGEEAAPESLDVVYRSTRSA |
| Protein accession: | NP_849192 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of RNF113B transfected lysate using anti-RNF113B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RNF113B MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |