| Brand: | Abnova |
| Reference: | H00140432-A01 |
| Product name: | RNF113B polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RNF113B. |
| Gene id: | 140432 |
| Gene name: | RNF113B |
| Gene alias: | MGC26599|RNF161|ZNF183L1|bA10G5.1 |
| Gene description: | ring finger protein 113B |
| Genbank accession: | NM_178861 |
| Immunogen: | RNF113B (NP_849192, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAAPPSPGRTADQADQVCTFLFKKPGRKGAAGLRKRPACDPEHGESSSSGDEGDTVAQPPRVAPRPRGLHSWQKAAHGDRRGEEAAPESLDVVYRSTRSA |
| Protein accession: | NP_849192 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |