No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00138046-B03P |
Product name: | RALYL purified MaxPab mouse polyclonal antibody (B03P) |
Product description: | Mouse polyclonal antibody raised against a full-length human RALYL protein. |
Gene id: | 138046 |
Gene name: | RALYL |
Gene alias: | HNRPCL3 |
Gene description: | RALY RNA binding protein-like |
Genbank accession: | BC031090.1 |
Immunogen: | RALYL (AAH31090.1, 1 a.a. ~ 291 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK |
Protein accession: | AAH31090.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RALYL expression in transfected 293T cell line (H00138046-T01) by RALYL MaxPab polyclonal antibody. Lane 1: RALYL transfected lysate(32.30 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | NONO and RALY proteins are required for YB-1 oxaliplatin induced resistance in colon adenocarcinoma cell lines.Tsofack SP, Garand C, Sereduk C, Chow D, Aziz M, Guay D, Yin HH, Lebel M. Mol Cancer. 2011 Nov 25;10(1):145. |