No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00136991-M01 |
Product name: | ASZ1 monoclonal antibody (M01), clone 3C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ASZ1. |
Clone: | 3C9 |
Isotype: | IgG2b Kappa |
Gene id: | 136991 |
Gene name: | ASZ1 |
Gene alias: | ALP1|ANKL1|C7orf7|GASZ|MGC26634|Orf3 |
Gene description: | ankyrin repeat, SAM and basic leucine zipper domain containing 1 |
Genbank accession: | NM_130768 |
Immunogen: | ASZ1 (NP_570124, 127 a.a. ~ 234 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLL |
Protein accession: | NP_570124 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged ASZ1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |