View larger

ASZ1 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of ASZ1 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00136991-A01
Product name:	ASZ1 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant ASZ1.
Gene id:	136991
Gene name:	ASZ1
Gene alias:	ALP1\|ANKL1\|C7orf7\|GASZ\|MGC26634\|Orf3
Gene description:	ankyrin repeat, SAM and basic leucine zipper domain containing 1
Genbank accession:	NM_130768
Immunogen:	ASZ1 (NP_570124, 127 a.a. ~ 234 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	QILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLL
Protein accession:	NP_570124
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.99 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	ASZ1 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of ASZ1 expression in HeLa ( Cat # L013V1 ).
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice