| Brand: | Abnova |
| Reference: | H00136991-A01 |
| Product name: | ASZ1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ASZ1. |
| Gene id: | 136991 |
| Gene name: | ASZ1 |
| Gene alias: | ALP1|ANKL1|C7orf7|GASZ|MGC26634|Orf3 |
| Gene description: | ankyrin repeat, SAM and basic leucine zipper domain containing 1 |
| Genbank accession: | NM_130768 |
| Immunogen: | ASZ1 (NP_570124, 127 a.a. ~ 234 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLL |
| Protein accession: | NP_570124 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ASZ1 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of ASZ1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |