No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00136319-B03P |
Product name: | MTPN purified MaxPab mouse polyclonal antibody (B03P) |
Product description: | Mouse polyclonal antibody raised against a full-length human MTPN protein. |
Gene id: | 136319 |
Gene name: | MTPN |
Gene alias: | FLJ31098|FLJ99857|GCDP|V-1 |
Gene description: | myotrophin |
Genbank accession: | NM_145808 |
Immunogen: | MTPN (NP_665807.1, 1 a.a. ~ 118 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ |
Protein accession: | NP_665807.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MTPN expression in transfected 293T cell line (H00136319-T04) by MTPN MaxPab polyclonal antibody. Lane 1: MTPN transfected lysate(12.90 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,IF,WB-Tr |
Shipping condition: | Dry Ice |