Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of WDR36 monoclonal antibody (M01), clone 1D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about WDR36 monoclonal antibody (M01), clone 1D6
| Brand: | Abnova |
| Reference: | H00134430-M01 |
| Product name: | WDR36 monoclonal antibody (M01), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant WDR36. |
| Clone: | 1D6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 134430 |
| Gene name: | WDR36 |
| Gene alias: | DKFZp686I1650|GLC1G|TA-WDRP|TAWDRP|UTP21 |
| Gene description: | WD repeat domain 36 |
| Genbank accession: | NM_139281 |
| Immunogen: | WDR36 (NP_644810, 853 a.a. ~ 951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL |
| Protein accession: | NP_644810 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged WDR36 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Glaucoma-associated WDR36 variants encode functional defects in a yeast model system.Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA. Hum Mol Genet. 2009 Apr 1;18(7):1276-87. Epub 2009 Jan 15. |