No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00133746-M05A |
Product name: | JMY monoclonal antibody (M05A), clone 5B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant JMY. |
Clone: | 5B6 |
Isotype: | IgG2a Kappa |
Gene id: | 133746 |
Gene name: | JMY |
Gene alias: | FLJ37870|MGC163496 |
Gene description: | junction-mediating and regulatory protein |
Genbank accession: | NM_152405 |
Immunogen: | JMY (NP_689618, 535 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPMDEVLASLKRGSFHLKKVEQRTLPPFPDEDDSNNILAQIRKGVKLKKVQKDVLRESFTLLPDTDPLTRSIHEALRRIKEASPESEDEEEALPCTDWEN |
Protein accession: | NP_689618 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | JMY monoclonal antibody (M05A), clone 5B6 Western Blot analysis of JMY expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |