No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00133060-M02 |
Product name: | OTOP1 monoclonal antibody (M02), clone 5E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OTOP1. |
Clone: | 5E3 |
Isotype: | IgG2a Kappa |
Gene id: | 133060 |
Gene name: | OTOP1 |
Gene alias: | MGC163302|MGC163304 |
Gene description: | otopetrin 1 |
Genbank accession: | NM_177998 |
Immunogen: | OTOP1 (NP_819056.1, 415 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AEGHPRYTWYNLPYSILAIVEKYIQNLFIFESIHREPEKLSEDIQTLRVVTVCNGNTMPLASSCPKSGGVARDVAPQGKDMPPAANGNVC |
Protein accession: | NP_819056.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | OTOP1 monoclonal antibody (M02), clone 5E3. Western Blot analysis of OTOP1 expression in MCF-7. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |