| Brand: | Abnova |
| Reference: | H00130507-A01 |
| Product name: | ZNF650 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ZNF650. |
| Gene id: | 130507 |
| Gene name: | UBR3 |
| Gene alias: | DKFZp434P117|DKFZp686N10185|FLJ37422|KIAA2024|MGC126489|ZNF650 |
| Gene description: | ubiquitin protein ligase E3 component n-recognin 3 (putative) |
| Genbank accession: | NM_172070 |
| Immunogen: | ZNF650 (NP_742067, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MNKRIIEEICRKVTPPVPPKKVTAAEKKTLDKEERRQKARERQQKLLAEFASRQKSFMETAMDVDSPENDIPMEITTAEPQVSEAVYDCVICGQSGPSSEDRPTGLVVLL |
| Protein accession: | NP_742067 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ZNF650 polyclonal antibody (A01), Lot # 051116JC01. Western Blot analysis of ZNF650 expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |