No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00130497-M31 |
Product name: | OSR1 monoclonal antibody (M31), clone 1C6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant OSR1. |
Clone: | 1C6 |
Isotype: | IgG2a Kappa |
Gene id: | 130497 |
Gene name: | OSR1 |
Gene alias: | ODD |
Gene description: | odd-skipped related 1 (Drosophila) |
Genbank accession: | NM_145260 |
Immunogen: | OSR1 (NP_660303, 29 a.a. ~ 108 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSV |
Protein accession: | NP_660303 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |