| Reference: | H00130497-M02 |
| Product name: | OSR1 monoclonal antibody (M02), clone 3E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant OSR1. |
| Clone: | 3E10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 130497 |
| Gene name: | OSR1 |
| Gene alias: | ODD |
| Gene description: | odd-skipped related 1 (Drosophila) |
| Genbank accession: | NM_145260 |
| Immunogen: | OSR1 (NP_660303, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP |
| Protein accession: | NP_660303 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |