Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACVR1C monoclonal antibody (M01), clone 2E3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,PLA-Ce |
More info about ACVR1C monoclonal antibody (M01), clone 2E3
| Brand: | Abnova |
| Reference: | H00130399-M01 |
| Product name: | ACVR1C monoclonal antibody (M01), clone 2E3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACVR1C. |
| Clone: | 2E3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 130399 |
| Gene name: | ACVR1C |
| Gene alias: | ACVRLK7|ALK7 |
| Gene description: | activin A receptor, type IC |
| Genbank accession: | BC022530 |
| Immunogen: | ACVR1C (AAH22530.1, 23 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM |
| Protein accession: | AAH22530.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between INHBB and ACVR1C. HeLa cells were stained with anti-INHBB rabbit purified polyclonal 1:1200 and anti-ACVR1C mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | ELISA,PLA-Ce |
| Shipping condition: | Dry Ice |