No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00129685-B01P |
Product name: | TBN purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human TBN protein. |
Gene id: | 129685 |
Gene name: | TAF8 |
Gene alias: | 43|FLJ32821|II|TAF|TAFII43|TBN |
Gene description: | TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa |
Genbank accession: | BC033728 |
Immunogen: | TBN (AAH33728.1, 1 a.a. ~ 174 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV |
Protein accession: | AAH33728.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TAF8 expression in transfected 293T cell line (H00129685-T02) by TAF8 MaxPab polyclonal antibody. Lane 1: TBN transfected lysate(19.14 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |