No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00128434-M02 |
| Product name: | C20orf102 monoclonal antibody (M02), clone 1A8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant C20orf102. |
| Clone: | 1A8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 128434 |
| Gene name: | VSTM2L |
| Gene alias: | C20orf102|dJ1118M15.2 |
| Gene description: | V-set and transmembrane domain containing 2 like |
| Genbank accession: | BC033818 |
| Immunogen: | C20orf102 (AAH33818.1, 25 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL |
| Protein accession: | AAH33818.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of VSTM2L expression in transfected 293T cell line by C20orf102 monoclonal antibody (M02), clone 1A8. Lane 1: VSTM2L transfected lysate(22.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |