Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C20orf102 monoclonal antibody (M01), clone 3B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about C20orf102 monoclonal antibody (M01), clone 3B9
| Brand: | Abnova |
| Reference: | H00128434-M01 |
| Product name: | C20orf102 monoclonal antibody (M01), clone 3B9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant C20orf102. |
| Clone: | 3B9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 128434 |
| Gene name: | VSTM2L |
| Gene alias: | C20orf102|dJ1118M15.2 |
| Gene description: | V-set and transmembrane domain containing 2 like |
| Genbank accession: | BC033818 |
| Immunogen: | C20orf102 (AAH33818.1, 25 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL |
| Protein accession: | AAH33818.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | C20orf102 monoclonal antibody (M01), clone 3B9 Western Blot analysis of C20orf102 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERSKlee, George G. ;Vasmatzis, George;Kosari, Farhad;Klee, Eric W. FreshPatents.com |