Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of VSTM2L MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr,IP |
More info about VSTM2L MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00128434-D01 |
| Product name: | VSTM2L MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human VSTM2L protein. |
| Gene id: | 128434 |
| Gene name: | VSTM2L |
| Gene alias: | C20orf102|dJ1118M15.2 |
| Gene description: | V-set and transmembrane domain containing 2 like |
| Genbank accession: | NM_080607.1 |
| Immunogen: | VSTM2L (NP_542174.1, 1 a.a. ~ 204 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL |
| Protein accession: | NP_542174.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of VSTM2L transfected lysate using anti-VSTM2L MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with VSTM2L purified MaxPab mouse polyclonal antibody (B01P) (H00128434-B01P). |
| Applications: | WB-Ti,WB-Tr,IP |
| Shipping condition: | Dry Ice |