No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00127943-M01 |
Product name: | FCRLB monoclonal antibody (M01), clone 2F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FCRLB. |
Clone: | 2F8 |
Isotype: | IgG2a Kappa |
Gene id: | 127943 |
Gene name: | FCRLB |
Gene alias: | FCRL2|FCRLM2|FCRLY|FLJ31052|FREB-2|FcRY|RP11-474I16.6 |
Gene description: | Fc receptor-like B |
Genbank accession: | NM_152378.1 |
Immunogen: | FCRLB (NP_689591.1, 89 a.a. ~ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DSLASCKAGAASPILGCRTRAECQSGCDMKRLAWSLFLSSFPRPSWTRSPCPTFQKAPLPPPRGHTASSPPPLVCGSARSPRGKQE |
Protein accession: | NP_689591.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged FCRLB is 3 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |