| Brand: | Abnova |
| Reference: | H00127343-M01 |
| Product name: | DMBX1 monoclonal antibody (M01), clone 1A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DMBX1. |
| Clone: | 1A9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 127343 |
| Gene name: | DMBX1 |
| Gene alias: | MBX|OTX3|PAXB |
| Gene description: | diencephalon/mesencephalon homeobox 1 |
| Genbank accession: | NM_147192 |
| Immunogen: | DMBX1 (NP_671725, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHRKQRRSRTAFTAQQLEALEK |
| Protein accession: | NP_671725 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |