Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of B3GALT6 monoclonal antibody (M06), clone 3E5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about B3GALT6 monoclonal antibody (M06), clone 3E5
| Brand: | Abnova |
| Reference: | H00126792-M06 |
| Product name: | B3GALT6 monoclonal antibody (M06), clone 3E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant B3GALT6. |
| Clone: | 3E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 126792 |
| Gene name: | B3GALT6 |
| Gene alias: | beta3GalT6 |
| Gene description: | UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 |
| Genbank accession: | NM_080605 |
| Immunogen: | B3GALT6 (NP_542172, 229 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP |
| Protein accession: | NP_542172 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged B3GALT6 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Impairment of glycosaminoglycan synthesis in mucopolysaccharidosis type IIIA cells by using siRNA: a potential therapeutic approach for Sanfilippo disease.Dziedzic D, Wegrzyn G, Jakobkiewicz-Banecka J. Eur J Hum Genet. 2010 Feb;18(2):200-5. Epub 2009 Aug 19. |