View larger

MGC33839 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of MGC33839 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00125875-B01P
Product name:	MGC33839 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human MGC33839 protein.
Gene id:	125875
Gene name:	CLDND2
Gene alias:	MGC33839
Gene description:	claudin domain containing 2
Genbank accession:	NM_152353
Immunogen:	MGC33839 (NP_689566, 1 a.a. ~ 167 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL
Protein accession:	NP_689566
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of MGC33839 expression in transfected 293T cell line by MGC33839 MaxPab polyclonal antibody. Lane 1: MGC33839 transfected lysate(18.37 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice