View larger

FLJ25006 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of FLJ25006 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00124923-B01P
Product name:	FLJ25006 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human FLJ25006 protein.
Gene id:	124923
Gene name:	FLJ25006
Gene alias:	MGC39533\|SGK494
Gene description:	uncharacterized serine/threonine-protein kinase SgK494
Genbank accession:	NM_144610.1
Immunogen:	FLJ25006 (NP_653211.1, 1 a.a. ~ 274 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQINHPFVHSLGDSWQGKRHLFIMCSYCSTDLYSLWSAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDVKMENILLDERGHLKLTDFGLSRHVPQGAQAYTICGTLQYMGERG
Protein accession:	NP_653211.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of FLJ25006 expression in transfected 293T cell line (H00124923-T01) by FLJ25006 MaxPab polyclonal antibody. Lane 1: FLJ25006 transfected lysate(30.14 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ti,WB-Tr
Shipping condition:	Dry Ice